PDB entry 3el1
View 3el1 on RCSB PDB site
Description: Crystal Structure of wild-type HIV protease in complex with the inhibitor, Atazanavir
Class: hydrolase
Keywords: HIV protease, protease inhibitors, drug resistance, Atazanavir, AIDS, Hydrolase, Protease
Deposited on
2008-09-19, released
2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3el1a_ - Chain 'B':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3el1b_ - Heterogens: DR7, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3el1A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3el1B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf