PDB entry 3ekx

View 3ekx on RCSB PDB site
Description: Crystal structure of the wild-type HIV-1 protease with the inhibitor, Nelfinavir
Class: hydrolase
Keywords: HIV protease, protease inhibitors, drug resistance, amprenavir, AIDS, Protease, HYDROLASE
Deposited on 2008-09-19, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (63)
    Domains in SCOPe 2.07: d3ekxa_
  • Chain 'B':
    Compound: Protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (63)
    Domains in SCOPe 2.07: d3ekxb_
  • Heterogens: 1UN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ekxA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ekxB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf