PDB entry 3ekp
View 3ekp on RCSB PDB site
Description: Crystal Structure of the inhibitor Amprenavir (APV) in complex with a multi-drug resistant HIV-1 protease variant (L10I/G48V/I54V/V64I/V82A)Refer: FLAP+ in citation
Class: hydrolase
Keywords: HIV-1, protease, multi-drug resistance, Amprenavir, AIDS, HYDROLASE
Deposited on
2008-09-19, released
2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (9)
- engineered (47)
- engineered (53)
- engineered (63)
- engineered (81)
Domains in SCOPe 2.07: d3ekpa_ - Chain 'B':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (9)
- engineered (47)
- engineered (53)
- engineered (63)
- engineered (81)
Domains in SCOPe 2.07: d3ekpb_ - Chain 'C':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (9)
- engineered (47)
- engineered (53)
- engineered (63)
- engineered (81)
Domains in SCOPe 2.07: d3ekpc_ - Chain 'D':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (9)
- engineered (47)
- engineered (53)
- engineered (63)
- engineered (81)
Domains in SCOPe 2.07: d3ekpd_ - Heterogens: PO4, ACT, 478, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ekpA (A:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ekpB (B:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3ekpC (C:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3ekpD (D:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf