PDB entry 3cuq

View 3cuq on RCSB PDB site
Description: Integrated structural and functional model of the human ESCRT-II complex
Class: protein transport
Keywords: ESCRT, Sorting, MBV, vps, Nucleus, Protein transport, Transcription, Transcription regulation, Transport, Endosome, Lipid-binding
Deposited on 2008-04-16, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar-sorting protein SNF8
    Species: Homo sapiens [TaxId:9606]
    Gene: SNF8, EAP30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cuqa1, d3cuqa2
  • Chain 'B':
    Compound: Vacuolar protein-sorting-associated protein 36
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS36, C13orf9, EAP45
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Vacuolar protein-sorting-associated protein 25
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS25, DERP9, EAP20
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Vacuolar protein-sorting-associated protein 25
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS25, DERP9, EAP20
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cuqA (A:)
    gtvlaedqlaqmskqldmfktnleefaskhkqeirknpefrvqfqdmcatigvdplasgk
    gfwsemlgvgdfyyelgvqiievclalkhrngglitleelhqqvlkgrgkfaqdvsqddl
    iraikklkalgtgfgiipvggtyliqsvpaelnmdhtvvlqlaekngyvtvseikaslkw
    eterarqvlehllkeglawldlqapgeahywlpalftdlysqeitaeearealp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cuqA (A:)
    aqmskqldmfktnleefaskhkqeirknpefrvqfqdmcatigvdplasgkgfwsemlgv
    gdfyyelgvqiievclalkhrngglitleelhqqvlkgrgkfaqdvsqddliraikklka
    lgtgfgiipvggtyliqsvpaelnmdhtvvlqlaekngyvtvseikaslkweterarqvl
    ehllkeglawldlqapgeahywlpalftdlysqeitaee
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.