PDB entry 2zxj

View 2zxj on RCSB PDB site
Description: Crystal structure of YycF DNA-binding domain from Staphylococcus aureus
Class: transcription
Keywords: two-component system, YycG, response regulator, helix-turn-helix motif, DNA-binding domain, transcriptional regulation, Activator, DNA-binding, Phosphoprotein, Transcription, Transcription regulation, Two-component regulatory system
Deposited on 2008-12-26, released 2009-01-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein walR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zxja_
  • Chain 'B':
    Compound: Transcriptional regulatory protein walR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zxjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zxjA (A:)
    mqpaqdtgnvtneitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtreh
    llqtvwgydyfgdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxjA (A:)
    neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
    gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zxjB (B:)
    mqpaqdtgnvtneitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtreh
    llqtvwgydyfgdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zxjB (B:)
    neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
    gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh