PDB entry 2zp4

View 2zp4 on RCSB PDB site
Description: Carboxylic ester hydrolase, single mutant h48n of bovine pancreatic pla2 enzyme
Class: hydrolase
Keywords: HYDROLASE, ACTIVE SITE MUTANT, METAL BINDING PROTEIN, Calcium, Lipid degradation, Metal-binding, Pyrrolidone carboxylic acid, Secreted
Deposited on 2008-06-27, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (47)
  Domains in SCOPe 2.07: d2zp4a_
• Heterogens: CA, CL, MRD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zp4A (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqtndncykqakklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  knc