PDB entry 2z9a

View 2z9a on RCSB PDB site
Description: Crystal Structure of Human Saposin C Dimer in Open Conformation
Class: lipid binding protein
Keywords: lipid binding protein, saposin, activator protein, sap, Disease mutation, Gaucher disease, Glycoprotein, GM2-gangliosidosis, Lipid metabolism, Lysosome, Metachromatic leukodystrophy, Sphingolipid metabolism
Deposited on 2007-09-18, released 2008-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proactivator polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAP, GLBA, SAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9aa_
  • Chain 'B':
    Compound: Proactivator polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAP, GLBA, SAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9ab_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2z9aA (A:)
yvsdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssi
lsilleevspelvcsmlhlcsrhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2z9aA (A:)
dvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssilsi
lleevspelvcsmlhlc

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2z9aB (B:)
yvsdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssi
lsilleevspelvcsmlhlcsrhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2z9aB (B:)
dvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssilsi
lleevspelvcsmlhlcs