PDB entry 2z6m

View 2z6m on RCSB PDB site
Description: Crystal structure of Human Ferritin H8 as biotemplate for noble metal nanoparticle synthesis
Class: Oxidoreductase
Keywords: Biotemplate, Iron, Iron storage, Metal-binding, Oxidoreductase, Phosphorylation
Deposited on 2007-08-04, released 2008-07-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6ma_
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mb_
  • Chain 'C':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mc_
  • Chain 'D':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6md_
  • Chain 'E':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6me_
  • Chain 'F':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mf_
  • Chain 'G':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mg_
  • Chain 'H':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mh_
  • Chain 'I':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mi_
  • Chain 'J':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mj_
  • Chain 'K':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6mk_
  • Chain 'L':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (Start-175)
      • engineered (12)
      • engineered (63)
      • engineered (89)
      • engineered (101)
      • engineered (104)
      • engineered (139)
      • engineered (142)
      • engineered (146)
    Domains in SCOPe 2.03: d2z6ml_
  • Heterogens: ZN, CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z6mA (A:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mA (A:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z6mB (B:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mB (B:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z6mC (C:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mC (C:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z6mD (D:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mD (D:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2z6mE (E:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mE (E:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2z6mF (F:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mF (F:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2z6mG (G:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mG (G:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2z6mH (H:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mH (H:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2z6mI (I:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mI (I:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2z6mJ (J:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mJ (J:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2z6mK (K:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mK (K:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2z6mL (L:)
    ttastsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerchaeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhkl
    atdkndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6mL (L:)
    tsqvrqnydqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerc
    haeklmklqnqrggriflqdikkpdrddwesglnameaalqleknvnqsllelhklatdk
    ndphlcdfiethylncqvcaikclgdhvtnlrkmgapesglaeylfdkhtlg