PDB entry 2z17
View 2z17 on RCSB PDB site
Description: Crystal sturcture of PDZ domain from human Pleckstrin homology, Sec7
Class: protein binding
Keywords: PDZ domain, Coiled coil, Cytoplasm, Membrane, Polymorphism, PROTEIN BINDING, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on
2007-05-08, released
2008-05-13
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.244
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pleckstrin homology Sec7 and coiled-coil domains-binding protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2z17a_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2z17A (A:)
gssgssglsdfswsqrklvtvekqdnetfgfeiqsyrpqnqnacssemftlickiqedsp
ahcaglqagdvlaningvstegftykqvvdlirssgnlltietl
Sequence, based on observed residues (ATOM records): (download)
>2z17A (A:)
fswsqrklvtvekqdnetfgfeiqsyrpqnqnacssemftlickiqedspahcaglqagd
vlaningvstegftykqvvdlirssgnlltietl