PDB entry 2yuq

View 2yuq on RCSB PDB site
Description: Solution structure of the SH3 domain of human Tyrosine-protein kinase ITK/TSK
Class: transferase
Keywords: T-cell-specific kinase, Tyrosine-protein kinase Lyk, Kinase EMT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase ITK/TSK
  Species: Homo sapiens [TaxId:9606]
  Gene: ITK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08881 (7-84)
    • expression tag (0-6)
  Domains in SCOPe 2.07: d2yuqa1, d2yuqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yuqA (A:)
  gssgssgednrrplwepeetvvialydyqtndpqelalrrneeyclldsseihwwrvqdr
  nghegyvpssylvekspnnletyew