PDB entry 2vxl

View 2vxl on RCSB PDB site
Description: screening a limited structure-based library identifies udp-galnac-specific mutants of alpha-1,3 galactosyltransferase
Class: transferase
Keywords: glycosyltransferase, galactosyltransferase, transmembrane, golgi apparatus, enzyme mechanism, glycoprotein, metal-binding, signal-anchor, alpha-1, membrane, manganese, transferase, transferase substrate specificity
Deposited on 2008-07-07, released 2008-09-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769 (0-276)
      • engineered mutation (198-201)
    Domains in SCOPe 2.04: d2vxla_
  • Heterogens: MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxlA (A:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
    rrkesaayipfgegdfyyagglfggtptqvlnitqecfkgilkdkkndieaqwhdeshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqt