PDB entry 2vka

View 2vka on RCSB PDB site
Description: site-directed mutagenesis of the catalytic tryptophan environment in pleurotus eryngii versatile peroxidase
Class: oxidoreductase
Keywords: lignin peroxidase, lignin degradation, manganese peroxidase, polyvalent peroxidase, aromatic-substrate binding, mn-independent oxidation, oxidoreductase
Deposited on 2007-12-18, released 2008-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: versatile peroxidase vpl2
  Species: PLEUROTUS ERYNGII [TaxId:5323]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O94753 (0-316)
    • engineered mutation (246)
  Domains in SCOPe 2.07: d2vkaa_
• Heterogens: SO4, CA, HEM, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vkaA (A:)
  atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
  adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
  pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
  ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
  acewqsfvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
  sdveqacaatpfpalta