PDB entry 2v7h

View 2v7h on RCSB PDB site
Description: crystal structure of an immunogen specific anti-mannopyranoside monoclonal antibody fab fragment
Class: immune system
Keywords: monoclonal antibody, mannopyranoside specificity, molecular mimicry, immune system
Deposited on 2007-07-30, released 2008-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2424
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7H (0-End)
    Domains in SCOPe 2.07: d2v7ha1, d2v7ha2
  • Chain 'B':
    Compound: monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d2v7hb2, d2v7hb3
  • Chain 'H':
    Compound: monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d2v7hh2, d2v7hh3
  • Chain 'L':
    Compound: monoclonal antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7H (0-End)
    Domains in SCOPe 2.07: d2v7hl1, d2v7hl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v7hA (A:)
    diqmtqttsslsaslgdrvtiscrasqdinnylnwyqqkpdgtvkiliyytsnlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgsarqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v7hB (B:)
    qaqlqqsgaelmkpgasvkisckatgytfsnywidwikqrpghglewigeilpgsgstny
    nekfrgkatftadtssntaymqlssltsedsavyyctrrgywaydfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7hB (B:)
    qaqlqqsgaelmkpgasvkisckatgytfsnywidwikqrpghglewigeilpgsgstny
    nekfrgkatftadtssntaymqlssltsedsavyyctrrgywaydfdywgqgttltvssa
    kttppsvyplapgsasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v7hH (H:)
    qaqlqqsgaelmkpgasvkisckatgytfsnywidwikqrpghglewigeilpgsgstny
    nekfrgkatftadtssntaymqlssltsedsavyyctrrgywaydfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v7hL (L:)
    diqmtqttsslsaslgdrvtiscrasqdinnylnwyqqkpdgtvkiliyytsnlhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgsarqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec