PDB entry 2v1w
View 2v1w on RCSB PDB site
Description: crystal structure of human lim protein ril (pdlim4) pdz domain bound to the c-terminal peptide of human alpha-actinin-1
Class: structural protein
Keywords: actin, stress, fibre dynamics, cytoskeleton, lim domain, metal-binding, phosphorylation, structural protein
Deposited on
2007-05-30, released
2007-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: pdz and lim domain protein 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2V1W (86-89)
- Uniprot P50479 (1-85)
Domains in SCOPe 2.04: d2v1wa_ - Chain 'B':
Compound: pdz and lim domain protein 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2V1W (86-89)
- Uniprot P50479 (1-85)
Domains in SCOPe 2.04: d2v1wb_ - Heterogens: EDO, MG, 1PE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2v1wA (A:)
smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
mthleaqnrikgchdhltlsvsrpegesdl
Sequence, based on observed residues (ATOM records): (download)
>2v1wA (A:)
mphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestelm
thleaqnrikgchdhltlsvsrpegesdl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2v1wB (B:)
smphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestel
mthleaqnrikgchdhltlsvsrpegesdl