PDB entry 2v1e

View 2v1e on RCSB PDB site
Description: crystal structure of radiation-induced myoglobin compound II - intermediate h at ph 6.8
Class: oxygen transport
Keywords: hydroxy radical, oxygen transport, oxygen activation, haem, iron, heme, ferryl, transport, peroxidase, reaction intermediate, monooxygenase, metal-binding, muscle protein
Deposited on 2007-05-23, released 2007-06-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.15
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2v1ea_
  • Heterogens: HEM, OH, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v1eA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg