PDB entry 2tma

View 2tma on RCSB PDB site
Description: tropomyosin crystal structure and muscle regulation. appendix. construction of an atomic model for tropomyosin and implications for interactions with actin
Class: contractile system protein
Keywords: contractile system protein
Deposited on 1987-09-16, released 1987-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 15 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tropomyosin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58772 (0-283)
      • conflict (196)
    Domains in SCOPe 2.07: d2tmaa_
  • Chain 'B':
    Compound: tropomyosin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58772 (0-283)
      • conflict (196)
    Domains in SCOPe 2.07: d2tmab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tmaA (A:)
    mdaikkkmqmlkldkenaldraeqaeadkkaaedrskqledelvslqkklkgtedeldky
    sealkdaqeklelaekkatdaeadvaslnrriqlveeeldraqerlatalqkleeaekaa
    desergmkviesraqkdeekmeiqeiqlkeakhiaedadrkyeevarklviiesdlerae
    eraelsegkcaeleeeiktvtnnlksleaqaekysqkedkyeeeikvlsdklkeaetrae
    faersvtkleksiddledelyaqklkykaiseeldhalndmtsi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2tmaB (B:)
    mdaikkkmqmlkldkenaldraeqaeadkkaaedrskqledelvslqkklkgtedeldky
    sealkdaqeklelaekkatdaeadvaslnrriqlveeeldraqerlatalqkleeaekaa
    desergmkviesraqkdeekmeiqeiqlkeakhiaedadrkyeevarklviiesdlerae
    eraelsegkcaeleeeiktvtnnlksleaqaekysqkedkyeeeikvlsdklkeaetrae
    faersvtkleksiddledelyaqklkykaiseeldhalndmtsi