PDB entry 2stb

View 2stb on RCSB PDB site
Description: anionic salmon trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor II)
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, trypsin inhibitor, hydrolase/hydrolase inhibitor complex
Deposited on 1998-12-11, released 2000-01-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35031 (0-221)
      • conflict (8)
      • conflict (12)
    Domains in SCOPe 2.03: d2stbe_
  • Chain 'I':
    Compound: protein (trypsin inhibitor)
    Species: Cucurbita pepo [TaxId:3663]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2stbi_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2stbE (E:)
ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2stbI (I:)
rvcpkilmeckkdsdclaeciclehgycg