PDB entry 2rpv

View 2rpv on RCSB PDB site
Description: Solution Structure of GB1 with LBT probe
Class: immune system
Keywords: lanthanide binding peptide, GB1, LBT, paramagnetic effect, olivia, Cell wall, IgG-binding protein, Peptidoglycan-anchor, Secreted, IMMUNE SYSTEM
Deposited on 2008-10-28, released 2009-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (19-74)
      • see remark 999 (0-18)
      • conflict (19-20)
      • engineered (37)
    Domains in SCOPe 2.04: d2rpva_
  • Heterogens: LA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2rpvA (A:)
cyvdtnndgayegdelsgtmeyklilngktlkgetttcavdaataekvfkqyandngvdg
ewtyddatktftvte