PDB entry 2rpn

View 2rpn on RCSB PDB site
Description: A crucial role for high intrinsic specificity in the function of yeast SH3 domains
Class: structural protein
Keywords: SH3 domain, extended peptide, 3-10 helix, Acetylation, Actin-binding, Cytoplasm, Cytoskeleton, Phosphoprotein, STRUCTURAL PROTEIN
Deposited on 2008-06-12, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-binding protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15891 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.07: d2rpna1, d2rpna2
  • Chain 'B':
    Compound: Actin-regulating kinase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53974 (1-17)
      • expression tag (0)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rpnA (A:)
    apwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn
    

  • Chain 'B':
    No sequence available.