PDB entry 2qvg

View 2qvg on RCSB PDB site
Description: The crystal structure of a two-component response regulator from Legionella pneumophila
Class: transferase
Keywords: 11016o, NYSGXRC, two component response regulator, PSI-2, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Transferase
Deposited on 2007-08-08, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.218
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two component response regulator
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg2457
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qvga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qvgA (A:)
    mslaadkvdilyleddevdiqsvervfhkisslikieiaksgnqaldmlygrnkenkihp
    klilldinipkmngieflkelrddssftdievfvltaaytskdklafeslnirghlikpl
    dygeaiklfwilqsmeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qvgA (A:)
    kvdilyleddevdiqsvervfhkisslikieiaksgnqaldmlygrnkenkihpklilld
    inipkmngieflkelrddssftdievfvltaaytskdklafeslnirghlikpldygeai
    klfwilqsm