PDB entry 2py1

View 2py1 on RCSB PDB site
Description: Solution structure of human liver fatty acid binding protein
Class: lipid binding protein
Keywords: beta structure, LIPID BINDING PROTEIN
Deposited on 2007-05-15, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, liver
  Species: Homo sapiens [TaxId:9606]
  Gene: FABP1, FABPL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07148 (2-128)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d2py1a1, d2py1a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2py1A (A:)
  gsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskv
  iqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdi
  vfkriskri