PDB entry 2pk4

View 2pk4 on RCSB PDB site
Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.148
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human plasminogen kringle 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2pk4a_
  • Heterogens: ACA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pk4A (A:)
    qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
    pwcfttdpsvrweycnlkkc