PDB entry 2phy

View 2phy on RCSB PDB site
Description: photoactive yellow protein, dark state (unbleached)
Class: photoreceptor
Keywords: light sensor for negative phototaxis, photoreceptor
Deposited on 1995-04-12, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Halorhodospira halophila [TaxId:1053]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.08: d2phya_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2phyA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv