PDB entry 2pcq

View 2pcq on RCSB PDB site
Description: Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
Class: lyase
Keywords: Lyase, Lysine Biosynthesis, Synthase, Dihydrodipicoliante, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative dihydrodipicolinate synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pcqa_
  • Heterogens: K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pcqA (A:)
    milppiptpfdregrldeeafrelaqaleplvdgllvygsngegvhltpeerarglralr
    prkpflvglmeetlpqaegalleakaagamallatppryyhgslgagllryyealaekmp
    lflyhvpqntkvdlpleavealaphpnvlgikdssgdlsriafyqarlqefrvytghapt
    flgalalgaeggilaaanlaprayralldhfregrlaeaqelqkklfplgdllakggvpl
    lkqalrhlglpagyprppypaesplwerflpvleglkeegwvl