PDB entry 2p4r

View 2p4r on RCSB PDB site
Description: Structural basis for a novel interaction between AIP4 and beta-PIX
Class: ligase
Keywords: SH3 domain peptide ligand complex, LIGASE
Deposited on 2007-03-13, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Arhgef7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O55043 (5-58)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d2p4ra1, d2p4ra2
  • Chain 'T':
    Compound: E3 ubiquitin-protein ligase Itchy homolog
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2p4rA (A:)
gplgsvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

    Sequence, based on observed residues (ATOM records): (download) 
    >2p4rA (A:)
svvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

  • Chain 'T':
    No sequence available.