PDB entry 2oaw
View 2oaw on RCSB PDB site
Description: Structure of SHH variant of "Bergerac" chimera of spectrin SH3
Class: structural protein
Keywords: SH3 domain, chimera, STRUCTURAL PROTEIN
Deposited on
2006-12-18, released
2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Spectrin alpha chain, brain
Species: Gallus gallus [TaxId:9031]
Database cross-references and differences (RAF-indexed):
- Uniprot P07751
- insertion (41-44)
- engineered (46)
- insertion (47-50)
Domains in SCOPe 2.07: d2oawa_ - Chain 'B':
Compound: Spectrin alpha chain, brain
Species: Gallus gallus [TaxId:9031]
Database cross-references and differences (RAF-indexed):
- Uniprot P07751
- insertion (41-44)
- engineered (46)
- insertion (47-50)
Domains in SCOPe 2.07: d2oawb_ - Chain 'C':
Compound: Spectrin alpha chain, brain
Species: Gallus gallus [TaxId:9031]
Database cross-references and differences (RAF-indexed):
- Uniprot P07751
- insertion (41-44)
- engineered (46)
- insertion (47-50)
Domains in SCOPe 2.07: d2oawc_ - Chain 'D':
Compound: Spectrin alpha chain, brain
Species: Gallus gallus [TaxId:9031]
Database cross-references and differences (RAF-indexed):
- Uniprot P07751 (0-64)
- insertion (41-44)
- engineered (46)
- insertion (47-50)
Domains in SCOPe 2.07: d2oawd_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2oawA (A:)
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
vkkld
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2oawB (B:)
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
vkkld
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2oawC (C:)
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
vkkld
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2oawD (D:)
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
vkkld