PDB entry 2o2n

View 2o2n on RCSB PDB site
Description: Solution structure of the anti-apoptotic protein Bcl-xL in complex with an acyl-sulfonamide-based ligand
Class: Apoptosis
Keywords: apoptosis, complex, bcl, NMR
Deposited on 2006-11-30, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis regulator bcl-x
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L1, BCL2L, BCLX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07817 (0-21)
      • insertion (22-23)
      • insertion (19)
      • insertion (25-27)
      • insertion (24)
    • Uniprot Q07817 (31-144)
    Domains in SCOPe 2.07: d2o2na_
  • Heterogens: LIW

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2o2nA (A:)
sqsnrelvvdflsyklsqkgysaggggggggmaavkqalreagdefelryrrafsdltsq
lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawma
tylndhlepwiqenggwdtfvelyg