PDB entry 2o13

View 2o13 on RCSB PDB site
Description: Solution structure of the C-terminal LIM domain of MLP/CRP3
Class: metal binding protein
Keywords: LIM domain, zinc binding, CRP, MLP, METAL BINDING PROTEIN
Deposited on 2006-11-28, released 2007-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muscle LIM protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CSRP3, CLP, MLP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2o13a1, d2o13a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2o13A (A:)
kcprcgksvyaaekvmgggkpwhktcfrcaicgkslestnvtdkdgelyckvcyaknf