PDB entry 2nxm

View 2nxm on RCSB PDB site
Description: Structure of HIV-1 protease D25N complexed with the rt-rh analogue peptide GLY-ALA-GLN-THR-PHE*TYR-VAL-ASP-GLY-ALA
Class: hydrolase/hydrolase substrate
Keywords: peptide design; molecular dynamics; hiv protease; substrate recognition; calorimetry, HYDROLASE-HYDROLASE SUBSTRATE COMPLEX
Deposited on 2006-11-17, released 2007-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11685]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered (6)
    • engineered (24)
  Domains in SCOPe 2.07: d2nxma_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11685]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered (6)
    • engineered (24)
  Domains in SCOPe 2.07: d2nxmb_
• Chain 'P':
  Compound: Analogue of RT-RH pol protease substrate peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2NXM
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nxmA (A:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nxmB (B:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'P':
  No sequence available.