PDB entry 2nxm
View 2nxm on RCSB PDB site
Description: Structure of HIV-1 protease D25N complexed with the rt-rh analogue peptide GLY-ALA-GLN-THR-PHE*TYR-VAL-ASP-GLY-ALA
Class: hydrolase/hydrolase substrate
Keywords: peptide design; molecular dynamics; hiv protease; substrate recognition; calorimetry, HYDROLASE-HYDROLASE SUBSTRATE COMPLEX
Deposited on
2006-11-17, released
2007-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11685]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot O38732 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOPe 2.07: d2nxma_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11685]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot O38732 (0-98)
- engineered (6)
- engineered (24)
Domains in SCOPe 2.07: d2nxmb_ - Chain 'P':
Compound: Analogue of RT-RH pol protease substrate peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2nxmA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2nxmB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'P':
No sequence available.