PDB entry 2nln

View 2nln on RCSB PDB site
Description: Solution Structure of Calcium-free Rat Beta-parvalbumin
Class: metal binding protein
Keywords: calcium-binding protein, rat beta parvalbumin, rat oncomodulin, metal binding protein
Deposited on 2006-10-20, released 2007-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Oncomodulin
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Ocm
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02631 (0-107)
  Domains in SCOPe 2.04: d2nlna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nlnA (A:)
  sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
  delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs