PDB entry 2nb1

View 2nb1 on RCSB PDB site
Description: P63/p73 hetero-tetramerisation domain
Class: transcription
Keywords: p63, p73, tetramerization domain, hetero tetramer, transcription factor, TRANSCRIPTION
Deposited on 2016-01-19, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tumor protein 63
  Species: Homo sapiens [TaxId:9606]
  Gene: KET, P63, P73H, P73L, TP63, TP73L
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H3D4
    • expression tag (0)
    • engineered mutation (20)
  Domains in SCOPe 2.07: d2nb1a1, d2nb1a2
• Chain 'B':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Gene: P73, TP73
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15350
    • expression tag (0-1)
    • engineered mutation (14)
  Domains in SCOPe 2.07: d2nb1b1, d2nb1b2
• Chain 'C':
  Compound: Tumor protein 63
  Species: Homo sapiens [TaxId:9606]
  Gene: KET, P63, P73H, P73L, TP63, TP73L
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H3D4 (1-59)
    • expression tag (0)
    • engineered mutation (20)
  Domains in SCOPe 2.07: d2nb1c1, d2nb1c2
• Chain 'D':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Gene: P73, TP73
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15350 (2-49)
    • expression tag (0-1)
    • engineered mutation (14)
  Domains in SCOPe 2.07: d2nb1d1, d2nb1d2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nb1A (A:)
  sddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nb1B (B:)
  gsdedtyylqvrgrknfeilmklkeslelmelvpqplvdsyrqqqqllqr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nb1C (C:)
  sddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nb1D (D:)
  gsdedtyylqvrgrknfeilmklkeslelmelvpqplvdsyrqqqqllqr