PDB entry 2n74

View 2n74 on RCSB PDB site
Description: Solution Structure of the RNA-Binding domain of non-structural protein 1 from the 1918 H1N1 influenza virus
Class: viral protein
Keywords: NS1, RIG-I, virulence, VIRAL PROTEIN
Deposited on 2015-09-03, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza A virus [TaxId:88776]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2n74a_
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza A virus [TaxId:88776]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2n74b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n74A (A:)
    mdsntvssfqvdcflwhvrkrfadqelgdapfldrlrrdqkslrgrgstlgldietatra
    gkqiverilkees
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n74B (B:)
    mdsntvssfqvdcflwhvrkrfadqelgdapfldrlrrdqkslrgrgstlgldietatra
    gkqiverilkees