PDB entry 2n3y

View 2n3y on RCSB PDB site
Description: NMR structure of the Y48pCMF variant of human cytochrome c in its reduced state
Class: electron transport
Keywords: Cytochrome c, hemeprotein, mitochondria, apoptosis, phosphorylation, ELECTRON TRANSPORT
Deposited on 2015-06-15, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Homo sapiens [TaxId:9606]
  Gene: CYCS, CYC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P99999 (0-103)
    • engineered mutation (47)
  Domains in SCOPe 2.07: d2n3ya_
• Heterogens: MH0

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n3yA (A:)
  gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysftaanknkgiiwg
  edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne