PDB entry 2mlk

View 2mlk on RCSB PDB site
Description: Three-dimensional structure of the C-terminal DNA-binding domain of RstA protein from Klebsiella pneumoniae
Class: signaling protein
Keywords: two component systems, SIGNALING PROTEIN
Deposited on 2014-03-02, released 2014-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: D364_07465
    Database cross-references and differences (RAF-indexed):
    • Uniprot U5MDD9 (10-118)
      • expression tag (9)
    Domains in SCOPe 2.04: d2mlka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2mlkA (A:)
mhhhhhhamgtltphktisfgsltidpvnrqvllggenvalstadfdllwelathagqim
drdallknlrgvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn

    Sequence, based on observed residues (ATOM records): (download) 
    >2mlkA (A:)
gtltphktisfgsltidpvnrqvllggenvalstadfdllwelathagqimdrdallknl
rgvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn