PDB entry 2mjd

View 2mjd on RCSB PDB site
Description: Oxidized Yeast Adrenodoxin Homolog 1
Class: metal binding protein
Keywords: Ferredoxin, Iron Sulfur Assembly, Paramagnetic Protein, 2FE2S cluster, METAL BINDING PROTEIN
Deposited on 2014-01-07, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adrenodoxin homolog, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YAH1, YPL252C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mjda_
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mjdA (A:)
geelkitfilkdgsqktyevcegetildiaqghnldmegacggscacstchvivdpdyyd
alpepeddendmldlaygltetsrlgcqikmskdidgirvalpqmtrnvnnndfs