PDB entry 2mgq

View 2mgq on RCSB PDB site
Description: Structure of CEH37 Homeodomain
Class: DNA binding protein
Keywords: Homeodomain, DNA binding protein, Telomere binding protein
Deposited on 2013-11-04, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homeobox protein ceh-37
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: ceh-37, C37E2.5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93356 (1-67)
    • expression tag (0)
  Domains in SCOPe 2.07: d2mgqa1, d2mgqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mgqA (A:)
  gprknrrerttysrqqleiletlfnetqypdvfarervadqirlqesriqvwfknrraky
  rlqekqkp