PDB entry 2mc9

View 2mc9 on RCSB PDB site
Description: Cat r 1
Class: isomerase
Keywords: cyclophilin, allergen, ISOMERASE
Deposited on 2013-08-16, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Catharanthus roseus [TaxId:4058]
    Gene: PCKR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39613 (6-177)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d2mc9a1, d2mc9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mc9A (A:)
gsftgsmpnprvffdmsvggqpagrivmelfadttprtaenfralctgekgtgrsgkplh
ykdssfhrvipgfmcqggdftagngtggesiygakfadenfikkhtgpgilsmanagpnt
ngsqffictaktewldgkhvvfgqvvegmdvvkaiekvgsssgrtakkvvvedcgqls