PDB entry 2m4n

View 2m4n on RCSB PDB site
Description: Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans
Class: unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, THIOREDOXIN-LIKE, New York Structural Genomics Research Consortium, NYSGRC, Assembly, Dynamics and Evolution of Cell-Cell and Cell-Matrix Adhesions, CELLMAT, PSI-Biology
Deposited on 2013-02-07, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein AFD-1, isoform a
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: afd-1, W03F11.6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BIC1 (1-107)
    • expression tag (0)
  Domains in SCOPe 2.07: d2m4na1, d2m4na2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m4nA (A:)
  smfggslkvyggeivptrpyvsilaeinenadrilgaalekyglehskddfilvevsndd
  drksmsdlreidgrpipptecplfemtarsgngengfdsflaikrkph