PDB entry 2ljm

View 2ljm on RCSB PDB site
Description: Solution Structure of CssII
Class: toxin
Keywords: CS alfa beta, TOXIN
Deposited on 2011-09-20, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-mammal toxin Css2
    Species: Centruroides suffusus suffusus [TaxId:6881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08900 (16-81)
      • expression tag (0-15)
    Domains in SCOPe 2.07: d2ljma1, d2ljma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ljmA (A:)
    mrgshhhhhhgsiegrkegylvskstgckyeclklgdndyclreckqqygkssggycyaf
    acwcthlyeqavvwplpnktcn