PDB entry 2l98

View 2l98 on RCSB PDB site
Description: Structure of trans-Resveratrol in complex with the cardiac regulatory protein Troponin C
Class: contractile protein
Keywords: structural protein, metal binding protein, contractile protein, antioxidant
Deposited on 2011-02-02, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (1-71)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2l98a_
  • Heterogens: CA, STL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l98A (A:)
mgkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgrid
ydeflefmkgve