PDB entry 2l6b

View 2l6b on RCSB PDB site
Description: NRC consensus ankyrin repeat protein solution structure
Class: de novo protein
Keywords: NRC, ankyrin, consensus, repeat protein, ising model, DE NOVO PROTEIN
Deposited on 2010-11-17, released 2011-03-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nr1c
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2L6B
    Domains in SCOPe 2.04: d2l6ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2l6bA (A:)
ghmwgskdgntplhnaaknghaeevkkllskgadvnarskdgntplhlaaknghaeivkl
llakgadvnarskdgntpehlakknghheivklldakgadvnarswgsshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2l6bA (A:)
wgskdgntplhnaaknghaeevkkllskgadvnarskdgntplhlaaknghaeivkllla
kgadvnarskdgntpehlakknghheivklldakgadvnarswgss