PDB entry 2kzj

View 2kzj on RCSB PDB site
Description: Solution structure of the ZHER2 Affibody (alternative)
Class: protein binding
Keywords: engineered protein, PROTEIN BINDING
Deposited on 2010-06-18, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Engineered protein, ZHER2 Affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 2KZJ (Start-69)
    Domains in SCOPe 2.07: d2kzja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2kzjA (A:)
mgsshhhhhhlqvdnkfnkemrnayweiallpnlnnqqkrafirslyddpsqsanllaea
kklndaqapk

    Sequence, based on observed residues (ATOM records): (download) 
    >2kzjA (A:)
vdnkfnkemrnayweiallpnlnnqqkrafirslyddpsqsanllaeakklndaqapk