PDB entry 2kri
View 2kri on RCSB PDB site
Description: Structure of a complex between domain V of beta2-glycoprotein I and the fourth ligand-binding module from LDLR determined with Haddock
Class: protein binding/endocytosis
Keywords: Antiphospholipid syndrome, Thrombosis, LDLR, Receptor, Disulfide bond, Glycoprotein, Heparin-binding, Sushi, PROTEIN BINDING-ENDOCYTOSIS complex
Deposited on
2009-12-18, released
2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated
2010-03-31, with a file datestamp of
2010-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Beta-2-glycoprotein 1
Species: Homo sapiens [TaxId:9606]
Gene: APOH, B2G1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2kria_ - Chain 'B':
Compound: low-density lipoprotein receptor
Species: Homo sapiens [TaxId:9606]
Gene: LDLR
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2krib_ - Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2kriA (A:)
gscklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtie
vpkcfkehsslafwktdasdvkpca
Sequence, based on observed residues (ATOM records): (download)
>2kriA (A:)
cklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtievp
kcfkehsslafwktdasdvkpc
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2kriB (B:)
tcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrg
Sequence, based on observed residues (ATOM records): (download)
>2kriB (B:)
tcgpasfqcnsstcipqlwacdndpdcedgsdewpqrc