PDB entry 2kop

View 2kop on RCSB PDB site
Description: NMR solution structures of 3-oxooctanyl-ACP from Streptomyces coelicolor Fatty Acid Synthase
Class: transport protein
Keywords: acyl carrier protein, intermediate binding, fatty acid synthase, Fatty acid biosynthesis, Lipid synthesis, Phosphopantetheine, TRANSPORT PROTEIN
Deposited on 2009-09-29, released 2010-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: acpP, SCO2389, SC4A7.17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2kopa_
  • Heterogens: SYO

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kopA (A:)
    aatqeeivaglaeivneiagipvedvkldksftddldvdslsmvevvvaaeerfdvkipd
    ddvknlktvgdatkyildhqa