PDB entry 2kdh

View 2kdh on RCSB PDB site
Description: The Solution Structure of Human Cardiac Troponin C in complex with the Green Tea Polyphenol; (-)-epigallocatechin-3-gallate
Class: structural protein
Keywords: CA2+ BINDING PROTEIN, CA2+ SENSITIZER, TROPONIN C, EGCG, Acetylation, Calcium, Cardiomyopathy, Disease mutation, Muscle protein, Polymorphism, STRUCTURAL PROTEIN
Deposited on 2009-01-09, released 2009-06-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (1-71)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d2kdha_
  • Heterogens: CA, KDH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kdhA (A:)
    mgkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgrid
    ydeflefmkgve