PDB entry 2k7d

View 2k7d on RCSB PDB site
Description: NMR Structure of Ca2+-bound CaBP1 C-domain
Class: metal binding protein
Keywords: EF-hand, calcium, CaBP1, IP3 receptor, NMR, Alternative splicing, Cell membrane, Cytoplasm, Cytoskeleton, Lipoprotein, Membrane, Myristate, METAL BINDING PROTEIN
Deposited on 2008-08-08, released 2008-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CABP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2k7da_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k7dA (A:)
admigvkelrdafrefdtngdgeistselreamrkllghqvghrdieeiirdvdlngdgr
vdfeefvrmmsr