PDB entry 2k79
View 2k79 on RCSB PDB site
Description: Solution Structure of the binary complex between the SH3 and SH2 domain of interleukin-2 tyrosine kinase
Class: Transferase
Keywords: SH3, SH2, novel, cis, ATP-binding, Cell membrane, Kinase, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Zinc, Zinc-finger
Deposited on
2008-08-08, released
2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-03-10, with a file datestamp of
2009-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: SH3 domain of Tyrosine-protein kinase ITK/TSK
Species: Mus musculus [TaxId:10090]
Gene: Itk, Emt, Tlk, Tsk
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2k79a1, d2k79a2 - Chain 'B':
Compound: SH2 domain of Tyrosine-protein kinase ITK/TSK
Species: Mus musculus [TaxId:10090]
Gene: Itk, Emt, Tlk, Tsk
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2k79b1, d2k79b2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2k79A (A:)
gspeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve
ksp
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2k79B (B:)
gsnnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpci
khyhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg
Sequence, based on observed residues (ATOM records): (download)
>2k79B (B:)
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg