PDB entry 2k3f

View 2k3f on RCSB PDB site
Description: Ribosomal protein L11 from Thermotoga maritima
Class: ribosomal protein
Keywords: L11, Ribosomal protein, Methylation, Ribonucleoprotein, RNA-binding
Deposited on 2008-05-06, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2k3fa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k3fA (A:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd