PDB entry 2jp2

View 2jp2 on RCSB PDB site
Description: Solution structure and resonance assignment of the N-terminal EVH1 domain from the human Spred2 protein (Sprouty-related protein with EVH1 domain isoform 2)
Class: signaling protein
Keywords: EVH1 domain, solution structure, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2007-04-18, released 2007-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sprouty-related, EVH1 domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SPRED2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z698 (2-125)
      • cloning artifact (0-1)
    Domains in SCOPe 2.04: d2jp2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jp2A (A:)
    gsmteethpdddsyivrvkavvmtrddssggwfpqegggisrvgvckvmhpegngrsgfl
    ihgerqkdklvvlecyvrkdlvytkanptfhhwkvdnrkfgltfqspadarafdrgvrka
    iedlie