PDB entry 2j97

View 2j97 on RCSB PDB site
Description: human coronavirus 229e non structural protein 9 (nsp9)
Class: RNA-binding protein
Keywords: ssb, zinc, hcov, membrane, helicase, sars cov, viral replicase, RNA replication, ATP-binding, nucleotide-binding, ribosomal frameshift, RNA-binding protein
Deposited on 2006-11-03, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1ab
    Species: HUMAN CORONAVIRUS 229E [TaxId:11137]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j97a_
  • Heterogens: MPD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j97A (A:)
    nneimpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgv
    vtveleppcrfvidtptgpqikylyfvknlnnlrrgavlgyigatvrlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j97A (A:)
    kmkvkatkgegdggitsegnalynnafmyayvttkpgmkyvkwehdsgvvtveleppcrf
    vidtptgpqikylyfvknlnnlrrgavlgyigatvrlq