PDB entry 2j97
View 2j97 on RCSB PDB site
Description: human coronavirus 229e non structural protein 9 (nsp9)
Class: RNA-binding protein
Keywords: ssb, zinc, hcov, membrane, helicase, sars cov, viral replicase, RNA replication, ATP-binding, nucleotide-binding, ribosomal frameshift, RNA-binding protein
Deposited on
2006-11-03, released
2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Replicase polyprotein 1ab
Species: HUMAN CORONAVIRUS 229E [TaxId:11137]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2j97a_ - Heterogens: MPD, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2j97A (A:)
nneimpgkmkvkatkgegdggitsegnalynneggrafmyayvttkpgmkyvkwehdsgv
vtveleppcrfvidtptgpqikylyfvknlnnlrrgavlgyigatvrlq
Sequence, based on observed residues (ATOM records): (download)
>2j97A (A:)
kmkvkatkgegdggitsegnalynnafmyayvttkpgmkyvkwehdsgvvtveleppcrf
vidtptgpqikylyfvknlnnlrrgavlgyigatvrlq